FASTA

Bách khoa toàn thư mở Wikipedia
Bước tới: menu, tìm kiếm

FASTA là một giải thuật bắt cặp trình tự được David J. LipmanWilliam R. Pearson miêu tả lần đầu tiên vào năm 1985 (Rapid and sensitive protein similarity searches).

Nhiều phần mềm tin sinh học cần dữ liệu trình tự gene hoặc protein theo kiểu định dạng FASTA như ví dụ minh hoạ dưới đây.

>tên trình tự 
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY